Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DIRC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159634
Description
DIRC2 Polyclonal specifically detects DIRC2 in Human samples. It is validated for Western Blot.Specifications
DIRC2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Q96SL1 | |
DIRC2 | |
Synthetic peptides corresponding to DIRC2(disrupted in renal carcinoma 2) The peptide sequence was selected from the middle region of DIRC2. Peptide sequence AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ. | |
Affinity Purified | |
RUO | |
84925 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Disrupted in renal cancer protein 2, disrupted in renal carcinoma 2, disrupted in renal carcinoma protein 2, RCC4FLJ14784, renal cell carcinoma 4 | |
Rabbit | |
52 kDa | |
100 μL | |
Primary | |
Porcine 86%. | |
Human, Mouse, Rat, Equine, Guinea Pig, Rabbit | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title