Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DIRC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | DIRC2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159634
|
Novus Biologicals
NBP159634 |
100 μL |
Each of 1 for $436.00
|
|
Description
DIRC2 Polyclonal specifically detects DIRC2 in Human samples. It is validated for Western Blot.Specifications
DIRC2 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Disrupted in renal cancer protein 2, disrupted in renal carcinoma 2, disrupted in renal carcinoma protein 2, RCC4FLJ14784, renal cell carcinoma 4 | |
DIRC2 | |
IgG | |
Affinity Purified | |
52 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q96SL1 | |
84925 | |
Synthetic peptides corresponding to DIRC2(disrupted in renal carcinoma 2) The peptide sequence was selected from the middle region of DIRC2. Peptide sequence AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title