Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DIS3L2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
Antigen | DIS3L2 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP18048020
|
Novus Biologicals
NBP18048020UL |
20 μL |
Each for $204.00
|
|
|||||
NBP180480
|
Novus Biologicals
NBP180480 |
100 μL |
Each for $482.50
|
|
|||||
Description
DIS3L2 Polyclonal specifically detects DIS3L2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
DIS3L2 | |
Polyclonal | |
Purified | |
RUO | |
DIS3 mitotic control homolog (S. cerevisiae)-like 2, DIS3-like exonuclease 2, FAM6A, member A | |
DIS3L2 | |
IgG | |
Protein A purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
NP_689596 | |
129563 | |
Synthetic peptide directed towards the N terminal of human MGC42174. Peptide sequence: MSHPDYRMNLRPLGTPRGVSAVAGPHDIGASPGDKKSKNRSTRGKKKSIF | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title