DKFZp566F084 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155201

Catalog No. NBP155201

Description

DKFZp566F084 Polyclonal specifically detects DKFZp566F084 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DKFZp566F084
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BVM2
• Gene Symbols: DPCD
• Immunogen: Synthetic peptides corresponding to RP11-529I10.4(deleted in a mouse model of primary ciliary dyskinesia) The peptide sequence was selected from the middle region of RP11-529I10.4. Peptide sequence APLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVD The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 25911
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: deleted in a mouse model of primary ciliary dyskinesia, deleted in primary ciliary dyskinesia homolog (mouse), DKFZP566F084, protein DPCD, RP11-529I10.4
• Host Species: Rabbit
• Molecular Weight of Antigen: 23 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.