DNA Primase small subunit Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP190897

Catalog No. NBP190897

Description

DNA Primase small subunit Polyclonal specifically detects DNA Primase small subunit in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DNA Primase small subunit
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: DNA primase 1, DNA primase 49 kDa subunit, DNA primase small subunit, DNA primase subunit 48, EC 2.7.7, EC 2.7.7.-, MGC12308, p49, primase p49 subunit, primase polypeptide 1, 49kDa, primase, DNA, polypeptide 1 (49kDa)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PRIM1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSG
• Quantity: 0.1 mL
• Research Discipline: Core ESC Like Genes, Lipid and Metabolism, Stem Cell Markers
• Gene ID (Entrez): 5557
• Target Species: Human
• Isotype: IgG

For Research Use Only