Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNAAF2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
Antigen | DNAAF2 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP170428
|
Novus Biologicals
NBP170428 |
100 μL |
Each of 1 for $436.00
|
N/A |
Description
DNAAF2 Polyclonal specifically detects DNAAF2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
DNAAF2 | |
Unconjugated | |
RUO | |
axonemal, dynein, axonemal, assembly factor 2 | |
DNAAF2 | |
IgG | |
Affinity Purified | |
91 kDa |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
55172 | |
Synthetic peptides corresponding to C14ORF104 The peptide sequence was selected from the N terminal of C14ORF104. Peptide sequence MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title