Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNAAF2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $329.00
Specifications
| Antigen | DNAAF2 |
|---|---|
| Immunogen | Synthetic peptides corresponding to C14ORF104 The peptide sequence was selected from the N terminal of C14ORF104. Peptide sequence MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP17042820 |
Novus Biologicals
NBP17042820UL |
20ul |
Each for $149.00
|
|
NBP170428 |
Novus Biologicals
NBP170428 |
100 ul |
Each for $329.00
|
|
Description
DNAAF2 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Western Blotting.Specifications
| DNAAF2 | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 55172 | |
| Affinity Purified | |
| Western Blot, Immunohistochemistry | |
| RUO |
| Synthetic peptides corresponding to C14ORF104 The peptide sequence was selected from the N terminal of C14ORF104. Peptide sequence MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG. | |
| Primary | |
| IgG | |
| axonemal, dynein, axonemal, assembly factor 2 | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title