Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DNAAF2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen DNAAF2
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
Regulatory Status RUO
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP170428
View Documents
Novus Biologicals
NBP170428
100 μL
Each of 1 for $436.00
N/A
Description

Description

DNAAF2 Polyclonal specifically detects DNAAF2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

DNAAF2
Unconjugated
RUO
axonemal, dynein, axonemal, assembly factor 2
DNAAF2
IgG
Affinity Purified
91 kDa
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
55172
Synthetic peptides corresponding to C14ORF104 The peptide sequence was selected from the N terminal of C14ORF104. Peptide sequence MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit