Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNAJB12 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | DNAJB12 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15944420
|
Novus Biologicals
NBP15944420UL |
20 μL |
Each for $152.22
|
|
NBP159444
|
Novus Biologicals
NBP159444 |
100 μL |
Each for $436.00
|
|
Description
DNAJB12 Polyclonal specifically detects DNAJB12 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
DNAJB12 | |
Unconjugated | |
RUO | |
Q9NXW2 | |
54788 | |
Synthetic peptides corresponding to DNAJB12(DnaJ (Hsp40) homolog, subfamily B, member 12) The peptide sequence was selected from the middle region of DNAJB12. Peptide sequence ILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFS. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DJ10FLJ20027, DKFZp586B2023, DnaJ (Hsp40) homolog, subfamily B, member 12, dnaJ homolog subfamily B member 12, FLJ0027 | |
DNAJB12 | |
IgG | |
Affinity Purified | |
42 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title