DNAJC10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159668

Catalog No. NBP159668

Description

DNAJC10 Polyclonal specifically detects DNAJC10 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DNAJC10
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp434J1813, DnaJ (Hsp40) homolog, subfamily C, member 10, dnaJ homolog subfamily C member 10, ERdj5, ER-resident protein ERdj5, J-domain-containing protein disulfide isomerase-like protein, JPDI, macrothioredoxin, MGC104194, MTHr
• Host Species: Rabbit
• Molecular Weight of Antigen: 91 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Chicken: 92%; Guinea pig: 92%; Equine: 92%; Zebrafish: 83%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8IXB1
• Gene Symbols: DNAJC10
• Immunogen: Synthetic peptides corresponding to DNAJC10(DnaJ (Hsp40) homolog, subfamily C, member 10) The peptide sequence was selected from the N terminal of DNAJC10. Peptide sequence DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAY.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54431
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.