Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNAJC10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | DNAJC10 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15966820
|
Novus Biologicals
NBP15966820UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP159668
|
Novus Biologicals
NBP159668 |
100 μL |
Each for $482.50
|
|
|||||
Description
DNAJC10 Polyclonal specifically detects DNAJC10 in Human samples. It is validated for Western Blot.Specifications
| DNAJC10 | |
| Polyclonal | |
| Rabbit | |
| Q8IXB1 | |
| 54431 | |
| Synthetic peptides corresponding to DNAJC10(DnaJ (Hsp40) homolog, subfamily C, member 10) The peptide sequence was selected from the N terminal of DNAJC10. Peptide sequence DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp434J1813, DnaJ (Hsp40) homolog, subfamily C, member 10, dnaJ homolog subfamily C member 10, ERdj5, ER-resident protein ERdj5, J-domain-containing protein disulfide isomerase-like protein, JPDI, macrothioredoxin, MGC104194, MTHr | |
| DNAJC10 | |
| IgG | |
| 91 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title