Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DNAJC10 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen DNAJC10
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15966820
View Documents
Novus Biologicals
NBP15966820UL
20 μL
Each for $152.22
Add to cart
 
NBP159668
View Documents
Novus Biologicals
NBP159668
100 μL
Each for $436.00
Add to cart
 
Description

Description

DNAJC10 Polyclonal specifically detects DNAJC10 in Human samples. It is validated for Western Blot.
Specifications

Specifications

DNAJC10
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
DKFZp434J1813, DnaJ (Hsp40) homolog, subfamily C, member 10, dnaJ homolog subfamily C member 10, ERdj5, ER-resident protein ERdj5, J-domain-containing protein disulfide isomerase-like protein, JPDI, macrothioredoxin, MGC104194, MTHr
DNAJC10
IgG
Affinity Purified
91 kDa
Western Blot
Unconjugated
RUO
Q8IXB1
54431
Synthetic peptides corresponding to DNAJC10(DnaJ (Hsp40) homolog, subfamily C, member 10) The peptide sequence was selected from the N terminal of DNAJC10. Peptide sequence DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAY.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit