Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNAJC19 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $329.00
Specifications
| Antigen | DNAJC19 |
|---|---|
| Immunogen | Synthetic peptides corresponding to DNAJC19 (DnaJ (Hsp40) homolog, subfamily C, member 19) The peptide sequence was selected from the C terminal of DNAJC19. Peptide sequence LGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP1689920 |
Novus Biologicals
NBP16899120UL |
20ul |
Each for $149.00
|
|
NBP168991 |
Novus Biologicals
NBP168991 |
100 ul |
Each for $329.00
|
|
Description
DNAJC19 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
| DNAJC19 | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 131118 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptides corresponding to DNAJC19 (DnaJ (Hsp40) homolog, subfamily C, member 19) The peptide sequence was selected from the C terminal of DNAJC19. Peptide sequence LGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK. | |
| Primary | |
| IgG | |
| DnaJ (Hsp40) homolog, subfamily C, member 19, DnaJ homolog subfamily C member 19, homolog of yeast TIM14, mitochondrial import inner membrane translocase subunit TIM14, Tim14, TIMM14TIM14Pam18 | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title