Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNAJC19 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | DNAJC19 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP168991
|
Novus Biologicals
NBP168991 |
100 μL |
Each of 1 for $436.00
|
|
Description
DNAJC19 Polyclonal specifically detects DNAJC19 in Human samples. It is validated for Western Blot.Specifications
DNAJC19 | |
Polyclonal | |
Rabbit | |
Vision | |
Q96DA6 | |
131118 | |
Synthetic peptides corresponding to DNAJC19 (DnaJ (Hsp40) homolog, subfamily C, member 19) The peptide sequence was selected from the C terminal of DNAJC19. Peptide sequence LGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. | |
13 kDa |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DnaJ (Hsp40) homolog, subfamily C, member 19, DnaJ homolog subfamily C member 19, homolog of yeast TIM14, mitochondrial import inner membrane translocase subunit TIM14, Tim14, TIMM14TIM14Pam18 | |
DNAJC19 | |
IgG | |
Affinity Purified | |
This product is specific to Subunit or Isoform: TIM14. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title