Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DNAJC19 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen DNAJC19
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP168991
View Documents
Novus Biologicals
NBP168991
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

DNAJC19 Polyclonal specifically detects DNAJC19 in Human samples. It is validated for Western Blot.
Specifications

Specifications

DNAJC19
Polyclonal
Rabbit
Vision
Q96DA6
131118
Synthetic peptides corresponding to DNAJC19 (DnaJ (Hsp40) homolog, subfamily C, member 19) The peptide sequence was selected from the C terminal of DNAJC19. Peptide sequence LGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK.
Primary
Store at -20C. Avoid freeze-thaw cycles.
13 kDa
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
DnaJ (Hsp40) homolog, subfamily C, member 19, DnaJ homolog subfamily C member 19, homolog of yeast TIM14, mitochondrial import inner membrane translocase subunit TIM14, Tim14, TIMM14TIM14Pam18
DNAJC19
IgG
Affinity Purified
This product is specific to Subunit or Isoform: TIM14.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit