Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNAJC25-GNG10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19155820UL
Description
DNAJC25-GNG10 Polyclonal specifically detects DNAJC25-GNG10 in Human samples. It is validated for Western Blot.Specifications
DNAJC25-GNG10 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_004116 | |
DNAJC25-GNG10 | |
Synthetic peptide directed towards the N terminal of human LOC552891. Peptide sequence AGALVEGLYCGTRDCYEVLGVSRSAGKAEIARAYRQLARRYHPDRYRPQP. | |
Affinity Purified | |
RUO | |
552891 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
DNAJC25-GNG10 readthrough | |
Rabbit | |
16 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction