Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DNASE1L2 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP19142920UL

 View more versions of this product

Catalog No. NBP19142920

Add to cart



DNASE1L2 Polyclonal antibody specifically detects Antigen in Rat samples. It is validated for Western Blotting.


PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptide directed towards the middle region of human LOC100364462. Peptide sequence LIPLHAAPNQAVAEIDALYDVYLDVIDKWNTDDMLFLGDFNADCKYVKAH.
40 kDa
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Western Blot 1:1000
deoxyribonuclease I-like 2, deoxyribonuclease-1-like 2, DHP1, DNAS1L2, DNase I homolog protein DHP1, DNase I-like 2
Immunogen affinity purified
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit