Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNASE1L2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19142920UL
Description
DNASE1L2 Polyclonal specifically detects DNASE1L2 in Rat samples. It is validated for Western Blot.Specifications
DNASE1L2 | |
Polyclonal | |
Western Blot 1:1000 | |
XP_002724704 | |
DNASE1L2 | |
Synthetic peptide directed towards the middle region of human LOC100364462. Peptide sequence LIPLHAAPNQAVAEIDALYDVYLDVIDKWNTDDMLFLGDFNADCKYVKAH. | |
Affinity Purified | |
RUO | |
1775 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
deoxyribonuclease I-like 2, deoxyribonuclease-1-like 2, DHP1, DNAS1L2, DNase I homolog protein DHP1, DNase I-like 2 | |
Rabbit | |
40 kDa | |
20 μL | |
Primary | |
Rat | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction