Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DNASE2B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen DNASE2B
Immunogen Synthetic peptides corresponding to DNASE2B(deoxyribonuclease II beta) The peptide sequence was selected from the middle region of DNASE2B. Peptide sequence IKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGG.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16227920 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16227920UL
20ul Each for $149.00
Add to cart
 
NBP162279 View Documents Novus BiologicalsSupplier Diversity Partner
NBP162279
100 ul Each for $329.00
Add to cart
 
Description

Description

DNASE2B Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

DNASE2B
Rabbit
Polyclonal
Unconjugated
58511
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to DNASE2B(deoxyribonuclease II beta) The peptide sequence was selected from the middle region of DNASE2B. Peptide sequence IKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGG.
Primary
IgG
deoxyribonuclease II betaDNase2-like acid DNase, DLADdeoxyribonuclease-2-beta, DNase II beta, DNase II-like acid DNase, EC 3.1.22.1, Endonuclease DLAD, lysosomal DNase II
PBS & 2% Sucrose. with No Preservative
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit