Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DNER Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179415

 View more versions of this product

Catalog No. NBP179415

Add to cart



DNER Polyclonal antibody specifically detects DNER in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
Synthetic peptide directed towards the middle region of human DNERThe immunogen for this antibody is DNER. Peptide sequence DACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDP.
Protein A purified
Store at -20C. Avoid freeze-thaw cycles.
Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Canine: 85%; Bovine: 78%; Guinea pig: 78%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat
Western Blot
Western Blot 1:1000
bet, delta and Notch-like epidermal growth factor-related receptor, delta/notch-like EGF repeat containing, delta-notch-like EGF repeat-containing transmembrane, H_NH0150O02.1, UNQ26, WUGSC:H_NH0150O02.1
Growth and Development, Neuronal Cell Markers
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit