DOG1/TMEM16A Mouse anti-Human, Alexa Fluor™ 594, Clone: DG1/447 + DOG-1.1, Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus Biologicals NBP234604AF594

Catalog No. NP234604A94

Description

DOG1/TMEM16A Monoclonal antibody specifically detects DOG1/TMEM16A in Human samples. It is validated for Western Blot,Flow Cytometry,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin),Immunohistochemistry (Frozen).

Specifications

• Antigen: DOG1/TMEM16A
• Clone: DG1/447 + DOG-1.1
• Dilution: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
• Gene Alias: ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A
• Host Species: Mouse
• Isotype: IgG
• Storage Requirements: Store at 4°C in the dark.
• Monoclonal or Polyclonal: Monoclonal
• Test Specificity: Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.

• Applications: Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
• Conjugate: Alexa Fluor™ 594
• Formulation: 50 mM sodium borate with 0.05% sodium azide
• Gene Symbols: ANO1
• Immunogen: Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (DOG-1.1)
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Gene ID (Entrez): 55107
• Target Species: Human