Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DOG1/TMEM16A Mouse anti-Human, Alexa Fluor™ 594, Clone: DG1/447 + DOG-1.1, Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus Biologicals NBP234604AF594

Catalog No. NP234604A94

Add to cart



DOG1/TMEM16A Monoclonal antibody specifically detects DOG1/TMEM16A in Human samples. It is validated for Western Blot,Flow Cytometry,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin),Immunohistochemistry (Frozen).


DG1/447 + DOG-1.1
Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A
Store at 4°C in the dark.
Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.
Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Alexa Fluor™ 594
50 mM sodium borate with 0.05% sodium azide
Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (DOG-1.1)
0.1 mL
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit