Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DOLPP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15998120UL
Description
DOLPP1 Polyclonal specifically detects DOLPP1 in Human samples. It is validated for Western Blot.Specifications
DOLPP1 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q86YN1 | |
DOLPP1 | |
Synthetic peptides corresponding to DOLPP1(dolichyl pyrophosphate phosphatase 1) The peptide sequence was selected from the N terminal of DOLPP1. Peptide sequence AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI. | |
20 μL | |
Protein Phosphatase | |
57171 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
dolichyl pyrophosphate phosphatase 1LSFR2, dolichyldiphosphatase 1, EC 3.6.1, EC 3.6.1.43, linked to Surfeit genes in Fugu rubripes 2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction