Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DOLPP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | DOLPP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1599820
|
Novus Biologicals
NBP15998120UL |
20 μL |
Each for $152.22
|
|
NBP159981
|
Novus Biologicals
NBP159981 |
100 μL |
Each for $436.00
|
|
Description
DOLPP1 Polyclonal specifically detects DOLPP1 in Human samples. It is validated for Western Blot.Specifications
DOLPP1 | |
Polyclonal | |
Rabbit | |
Protein Phosphatase | |
Q86YN1 | |
57171 | |
Synthetic peptides corresponding to DOLPP1(dolichyl pyrophosphate phosphatase 1) The peptide sequence was selected from the N terminal of DOLPP1. Peptide sequence AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
dolichyl pyrophosphate phosphatase 1LSFR2, dolichyldiphosphatase 1, EC 3.6.1, EC 3.6.1.43, linked to Surfeit genes in Fugu rubripes 2 | |
DOLPP1 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title