Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Dopamine beta-Hydroxylase Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP257836

Catalog No. NBP257836


Add to cart

Description

Description

Dopamine beta-Hydroxylase Polyclonal antibody specifically detects Dopamine beta-Hydroxylase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

Dopamine beta-Hydroxylase
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
DBM, dopamine beta-hydroxylase, dopamine beta-hydroxylase (dopamine beta-monooxygenase), Dopamine beta-monooxygenase, EC 1.14.17.1
Rabbit
IgG
100 ul
Cancer, Lipid and Metabolism, Neuroscience
Primary
1621
Human
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Western Blot 0.4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Affinity Purified
DBH
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LINRFNNEDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQ
Affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only