Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen DP1
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence
Applications Western Blot, Immunohistochemistry, Immunofluorescence
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126656
View Documents
Novus Biologicals
NBP31087725UL
25 μg
Each for $106.19
Add to cart
 
NB126655
View Documents
Novus Biologicals
NBP310877100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

DP1 Polyclonal antibody specifically detects DP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence
Specifications

Specifications

DP1
Western Blot, Immunohistochemistry, Immunofluorescence
Purified
RUO
Human
DP1E2F dimerization partner 1, DRTF1Dp-1, DRTF1-polypeptide 1, E2F-related transcription factor, transcription factor Dp-1
The immunogen is a synthetic peptide directed towards the N terminal region of human DP1 (NP_009042). Peptide sequence VIGTPQRPAASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKN
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence
Unconjugated
Rabbit
Cell Cycle and Replication, DNA Repair, DNA replication Transcription Translation and Splicing
PBS buffer, 2% sucrose
7027
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit