Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DPP6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159427
Description
DPP6 Polyclonal specifically detects DPP6 in Human, Mouse samples. It is validated for Western Blot.Specifications
DPP6 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
dipeptidyl aminopeptidase IV-related protein, dipeptidyl aminopeptidase-like protein 6, Dipeptidyl aminopeptidase-related protein, Dipeptidyl peptidase 6, Dipeptidyl peptidase IV-like protein, dipeptidyl peptidase IV-related protein, Dipeptidyl peptidase VI, dipeptidylpeptidase 6, dipeptidyl-peptidase 6, dipeptidylpeptidase VI, DPP VI, DPPXFLJ55680, MGC46605, VF2 | |
Rabbit | |
Affinity purified | |
RUO | |
1804 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
P42658 | |
DPP6 | |
Synthetic peptides corresponding to DPP6(dipeptidyl-peptidase 6) The peptide sequence was selected from the middle region of DPP6. Peptide sequence FLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQ. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 92%; Zebrafish: 85%. | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction