Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DPYS Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen DPYS
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155122
View Documents
Novus Biologicals
NBP155122
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

DPYS Polyclonal specifically detects DPYS in Human samples. It is validated for Western Blot.
Specifications

Specifications

DPYS
Polyclonal
Purified
RUO
Q14117
1807
Synthetic peptides corresponding to DPYS(dihydropyrimidinase) The peptide sequence was selected from the middle region of DPYS. Peptide sequence LRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVN.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
DHPasehydantoinase, DHPHydantoinase, dihydropyrimidinase, Dihydropyrimidine amidohydrolase, EC 3.5.2.2
DPYS
IgG
Protein A purified
56 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit