DPYS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155121

Catalog No. NBP155121

Description

DPYS Polyclonal specifically detects DPYS in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DPYS
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DHPasehydantoinase, DHPHydantoinase, dihydropyrimidinase, Dihydropyrimidine amidohydrolase, EC 3.5.2.2
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q14117
• Gene Symbols: DPYS
• Immunogen: Synthetic peptides corresponding to DPYS(dihydropyrimidinase) The peptide sequence was selected from the N terminal of DPYS. Peptide sequence VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1807
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified