Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DPYS Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP155121
Description
DPYS Polyclonal specifically detects DPYS in Human samples. It is validated for Western Blot.Specifications
DPYS | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Q14117 | |
DPYS | |
Synthetic peptides corresponding to DPYS(dihydropyrimidinase) The peptide sequence was selected from the N terminal of DPYS. Peptide sequence VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID. | |
Protein A purified | |
RUO | |
1807 | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Guinea Pig, Rabbit, Zebrafish | |
Purified |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DHPasehydantoinase, DHPHydantoinase, dihydropyrimidinase, Dihydropyrimidine amidohydrolase, EC 3.5.2.2 | |
Rabbit | |
56 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title