Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DRG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15515820UL
Description
DRG1 Polyclonal specifically detects DRG1 in Human samples. It is validated for Western Blot.Specifications
DRG1 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
developmentally regulated GTP binding protein 1, developmentally regulated GTP-binding protein 1, developmentally-regulated GTP-binding protein 1, DKFZp434N1827, DRG-1, NEDD3, NEDD-3, Neural precursor cell expressed developmentally down-regulated protein 3, neural precursor cell expressed, developmentally down-regulated 3 | |
Rabbit | |
26 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DRG1 | |
Synthetic peptides corresponding to DRG1(developmentally regulated GTP binding protein 1) The peptide sequence was selected from the middle region of DRG1. Peptide sequence VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL. | |
Affinity Purified | |
RUO | |
4733 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction