Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DRG1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | DRG1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15515820
|
Novus Biologicals
NBP15515820UL |
20 μL |
Each for $152.22
|
|
NBP155158
|
Novus Biologicals
NBP155158 |
100 μL |
Each for $436.00
|
|
Description
DRG1 Polyclonal specifically detects DRG1 in Human samples. It is validated for Western Blot.Specifications
| DRG1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 4733 | |
| Synthetic peptides corresponding to DRG1(developmentally regulated GTP binding protein 1) The peptide sequence was selected from the middle region of DRG1. Peptide sequence VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| developmentally regulated GTP binding protein 1, developmentally regulated GTP-binding protein 1, developmentally-regulated GTP-binding protein 1, DKFZp434N1827, DRG-1, NEDD3, NEDD-3, Neural precursor cell expressed developmentally down-regulated protein 3, neural precursor cell expressed, developmentally down-regulated 3 | |
| DRG1 | |
| IgG | |
| Affinity Purified | |
| 26 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title