Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Drosha Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | Drosha |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP157139
|
Novus Biologicals
NBP157139 |
100 μL |
Each for $436.00
|
|
NBP15713920
|
Novus Biologicals
NBP15713920UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
Drosha Polyclonal specifically detects Drosha in Human samples. It is validated for Western Blot.Specifications
Drosha | |
Polyclonal | |
Rabbit | |
Epigenetics, microRNA | |
drosha, double-stranded RNA-specific endoribonuclease, drosha, ribonuclease type III, EC 3.1.26.3, Etohi2, nuclear RNase III Drosha, p241, Protein Drosha, putative protein p241 which interacts with transcription factor Sp1, putative ribonuclease III, RANSE3L, ribonuclease 3, Ribonuclease III, ribonuclease III, nuclear, RN3nuclear, RNase III | |
DROSHA | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q9NRR4 | |
29102 | |
Synthetic peptides corresponding to RNASEN(ribonuclease type III, nuclear) The peptide sequence was selected from the middle region of RNASEN. Peptide sequence AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title