Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DTD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | DTD2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179499
|
Novus Biologicals
NBP179499 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
DTD2 Polyclonal specifically detects DTD2 in Human samples. It is validated for Western Blot.Specifications
| DTD2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C14orf126, chromosome 14 open reading frame 126, EC 3.1, MGC9912, probable D-tyrosyl-tRNA(Tyr) deacylase 2 | |
| DTD2 | |
| IgG | |
| Affinity Purified | |
| 19 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_542395 | |
| 112487 | |
| Synthetic peptide directed towards the middle region of human C14orf126The immunogen for this antibody is C14orf126. Peptide sequence ETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title