Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DTX2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | DTX2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP153119
|
Novus Biologicals
NBP153119 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
DTX2 Polyclonal specifically detects DTX2 in Human samples. It is validated for Western Blot.Specifications
DTX2 | |
Polyclonal | |
Rabbit | |
Zinc Finger | |
deltex (Drosophila) homolog 2, deltex homolog 2 (Drosophila), Deltex2, hDTX2, MGC71098, protein deltex-2, RING finger protein 58, RNF58KIAA1528deltex2, zinc ion binding protein | |
DTX2 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q6XM87 | |
113878 | |
Synthetic peptides corresponding to DTX2(deltex homolog 2 (Drosophila)) The peptide sequence was selected from the C terminal of DTX2. Peptide sequence EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title