DTX3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169022

Catalog No. NBP169022

Description

DTX3 Polyclonal specifically detects DTX3 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: DTX3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q80V91
• Gene Symbols: DTX3
• Immunogen: Synthetic peptides corresponding to Dtx3 (deltex 3 homolog (Drosophila)) The peptide sequence was selected from the C terminal of Dtx3. Peptide sequence YEKYGTIVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTL.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 196403
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: deltex 3 homolog (Drosophila), deltex homolog 3 (Drosophila), deltex3, FLJ34766, MGC138863, MGC138864, protein deltex-3, RING finger protein 154, RNF154deltex 3 homolog
• Host Species: Rabbit
• Molecular Weight of Antigen: 38 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.