Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DTX3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | DTX3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP16902220
|
Novus Biologicals
NBP16902220UL |
20 μL |
Each for $152.22
|
|
NBP169022
|
Novus Biologicals
NBP169022 |
100 μL |
Each for $436.00
|
|
Description
DTX3 Polyclonal specifically detects DTX3 in Mouse samples. It is validated for Western Blot.Specifications
DTX3 | |
Polyclonal | |
Rabbit | |
Q80V91 | |
196403 | |
Synthetic peptides corresponding to Dtx3 (deltex 3 homolog (Drosophila)) The peptide sequence was selected from the C terminal of Dtx3. Peptide sequence YEKYGTIVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
deltex 3 homolog (Drosophila), deltex homolog 3 (Drosophila), deltex3, FLJ34766, MGC138863, MGC138864, protein deltex-3, RING finger protein 154, RNF154deltex 3 homolog | |
DTX3 | |
IgG | |
Affinity Purified | |
38 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title