Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DTX3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen DTX3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16902220
View Documents
Novus Biologicals
NBP16902220UL
20 μL
Each for $152.22
Add to cart
 
NBP169022
View Documents
Novus Biologicals
NBP169022
100 μL
Each for $436.00
Add to cart
 
Description

Description

DTX3 Polyclonal specifically detects DTX3 in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

DTX3
Polyclonal
Rabbit
Q80V91
196403
Synthetic peptides corresponding to Dtx3 (deltex 3 homolog (Drosophila)) The peptide sequence was selected from the C terminal of Dtx3. Peptide sequence YEKYGTIVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTL.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
deltex 3 homolog (Drosophila), deltex homolog 3 (Drosophila), deltex3, FLJ34766, MGC138863, MGC138864, protein deltex-3, RING finger protein 154, RNF154deltex 3 homolog
DTX3
IgG
Affinity Purified
38 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit