Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ DUSP10 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Supplier: Novus Biologicals™ NBP182640PEP
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DUSP10. The DUSP10 Recombinant Protein Antigen is derived from E. coli. The DUSP10 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
11221 | |
Chromatography | |
0.5mg/mL | |
PBS and 1M Urea, pH 7.4. | |
DUSP10 | |
30kDa | |
0.1mL | |
E.Coli | |
FMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQ |
Human | |
>80% | |
Store at -20°C. Avoid freeze-thaw cycles. | |
Blocking/Neutralizing, Control | |
Unlabeled | |
DUSP10 | |
RUO | |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82640. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Safety and Handling
ShelfLife : 365
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction