Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DUSP11 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen DUSP11
Immunogen Synthetic peptides corresponding to Dusp11 (dual specificity phosphatase 11 (RNA/RNP complex 1-interacting)) The peptide sequence was selected from the N terminal of Dusp11. Peptide sequence GQRMPGTRFIAFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGL
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16891920 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16891920UL
20ul Each for $149.00
Add to cart
 
NBP168919 View Documents Novus BiologicalsSupplier Diversity Partner
NBP168919
100 ul Each for $329.00
Add to cart
 
Description

Description

DUSP11 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

DUSP11
Rabbit
Polyclonal
Unconjugated
8446
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to Dusp11 (dual specificity phosphatase 11 (RNA/RNP complex 1-interacting)) The peptide sequence was selected from the N terminal of Dusp11. Peptide sequence GQRMPGTRFIAFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGL
Primary
IgG
dual specificity phosphatase 11 (RNA/RNP complex 1-interacting), Dual specificity protein phosphatase 11, EC 3.1.3.-, Phosphatase that interacts with RNA/RNP complex 1, PIR1RNA/RNP complex-interacting phosphatase, RNA/RNP complex-1-interacting phosphatase, serine/threonine specific protein phosphatase
PBS & 2% Sucrose. with No Preservative
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit