Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DUSP11 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $329.00
Specifications
| Antigen | DUSP11 |
|---|---|
| Immunogen | Synthetic peptides corresponding to Dusp11 (dual specificity phosphatase 11 (RNA/RNP complex 1-interacting)) The peptide sequence was selected from the N terminal of Dusp11. Peptide sequence GQRMPGTRFIAFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGL |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP16891920 |
Novus Biologicals
NBP16891920UL |
20ul |
Each for $149.00
|
|
NBP168919 |
Novus Biologicals
NBP168919 |
100 ul |
Each for $329.00
|
|
Description
DUSP11 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.Specifications
| DUSP11 | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 8446 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptides corresponding to Dusp11 (dual specificity phosphatase 11 (RNA/RNP complex 1-interacting)) The peptide sequence was selected from the N terminal of Dusp11. Peptide sequence GQRMPGTRFIAFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGL | |
| Primary | |
| IgG | |
| dual specificity phosphatase 11 (RNA/RNP complex 1-interacting), Dual specificity protein phosphatase 11, EC 3.1.3.-, Phosphatase that interacts with RNA/RNP complex 1, PIR1RNA/RNP complex-interacting phosphatase, RNA/RNP complex-1-interacting phosphatase, serine/threonine specific protein phosphatase | |
| PBS & 2% Sucrose. with No Preservative | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title