DUSP5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179716

Catalog No. NBP179716

Description

DUSP5 Polyclonal specifically detects DUSP5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DUSP5
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_004410
• Gene Symbols: DUSP5
• Immunogen: Synthetic peptide directed towards the middle region of human DUSP5. Peptide sequence: AGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATS
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Predicted Homology Based On Immunogen Sequence: Mouse: 86%; Rabbit: 86%; Bovine: 85%; Rat: 79%; Guinea pig: 79%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dual specificity phosphatase 5, dual specificity protein phosphatase 5, Dual specificity protein phosphatase hVH3, DUSP, EC 3.1.3.16, EC 3.1.3.48, HVH3VH1-like phosphatase 3, serine/threonine specific protein phosphatase, VH3
• Host Species: Rabbit
• Molecular Weight of Antigen: 42 kDa
• Quantity: 100 μL
• Research Discipline: Protein Phosphatase
• Gene ID (Entrez): 1847
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.