Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DUSP5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | DUSP5 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179716
|
Novus Biologicals
NBP179716 |
100 μL |
Each of 1 for $436.00
|
|
Description
DUSP5 Polyclonal specifically detects DUSP5 in Human samples. It is validated for Western Blot.Specifications
DUSP5 | |
Polyclonal | |
Rabbit | |
Protein Phosphatase | |
NP_004410 | |
1847 | |
Synthetic peptide directed towards the middle region of human DUSP5. Peptide sequence: AGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATS | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
dual specificity phosphatase 5, dual specificity protein phosphatase 5, Dual specificity protein phosphatase hVH3, DUSP, EC 3.1.3.16, EC 3.1.3.48, HVH3VH1-like phosphatase 3, serine/threonine specific protein phosphatase, VH3 | |
DUSP5 | |
IgG | |
Affinity Purified | |
42 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title