Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DUSP5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen DUSP5
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP179716
View Documents
Novus Biologicals
NBP179716
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

DUSP5 Polyclonal specifically detects DUSP5 in Human samples. It is validated for Western Blot.
Specifications

Specifications

DUSP5
Polyclonal
Rabbit
Protein Phosphatase
NP_004410
1847
Synthetic peptide directed towards the middle region of human DUSP5. Peptide sequence: AGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATS
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
dual specificity phosphatase 5, dual specificity protein phosphatase 5, Dual specificity protein phosphatase hVH3, DUSP, EC 3.1.3.16, EC 3.1.3.48, HVH3VH1-like phosphatase 3, serine/threonine specific protein phosphatase, VH3
DUSP5
IgG
Affinity Purified
42 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit