Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DYSFIP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | DYSFIP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP155526
|
Novus Biologicals
NBP155526 |
100 μL |
Each of 1 for $436.00
|
|
Description
DYSFIP1 Polyclonal specifically detects DYSFIP1 in Human samples. It is validated for Western Blot.Specifications
DYSFIP1 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
dysferlin interacting protein 1, dysferlin interacting protein 1 (toonin), dysferlin-interacting protein 1, dysferlin-interacting protein 1 (toonin), MGC138299, toonin | |
PPP1R27 | |
IgG | |
Affinity Purified | |
17 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q86WC6 | |
116729 | |
Synthetic peptides corresponding to DYSFIP1(dysferlin interacting protein 1) The peptide sequence was selected from the middle region of DYSFIP1. Peptide sequence CSDGYPDIARYLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title