Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

E2F-2 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen E2F-2
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Applications Western Blot, Immunohistochemistry
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125858
View Documents
Novus Biologicals
NBP31047825UL
25 μg
Each for $106.19
Add to cart
 
NB125857
View Documents
Novus Biologicals
NBP310478100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

E2F-2 Polyclonal antibody specifically detects E2F-2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry
Specifications

Specifications

E2F-2
Western Blot, Immunohistochemistry
Purified
RUO
Human, Mouse
E2F transcription factor 2, E2F-2transcription factor E2F2
The immunogen is a synthetic peptide directed towards the middle region of human E2F-2 (NP_004082). Peptide sequence DQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLI
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Immunohistochemistry
Unconjugated
Rabbit
Cell Cycle and Replication, Transcription Factors and Regulators
PBS buffer, 2% sucrose
1870
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit