Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

E74 like factor 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen E74 like factor 1
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Applications Western Blot, Immunohistochemistry
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126688
View Documents
Novus Biologicals
NBP31089325UL
25 μg
Each for $106.19
Add to cart
 
NB126687
View Documents
Novus Biologicals
NBP310893100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

E74 like factor 1 Polyclonal antibody specifically detects E74 like factor 1 in Human samples. It is validated for Western Blot, Immunohistochemistry
Specifications

Specifications

E74 like factor 1
Western Blot, Immunohistochemistry
Purified
RUO
Human
E74-like factor 1, E74-like factor 1 (ets domain transcription factor), ETS-related transcription factor Elf-1
The immunogen is a synthetic peptide directed towards the N terminal region of human E74 like factor 1 (NP_758961). Peptide sequence VTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATT
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Immunohistochemistry
Unconjugated
Rabbit
Cellular Markers
PBS buffer, 2% sucrose
1997
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit