Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EAR2/NR2F6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP152818

 View more versions of this product

Catalog No. NBP152818

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

EAR2/NR2F6 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Western Blotting.
Specifications

Specifications

EAR2/NR2F6
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
NR2F6
Synthetic peptides corresponding to NR2F6(nuclear receptor subfamily 2, group F, member 6) The peptide sequence was selected from the N terminal of NR2F6. Peptide sequence AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV.
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Xenopus: 78%.
Human
Immunohistochemistry, Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry
P10588
EAR-2ERBA-related gene-2, EAR2nuclear receptor subfamily 2 group F member 6, ERBAL2v-erb-a avian erythroblastic leukemia viral oncogene homolog-like 2, nuclear receptor subfamily 2, group F, member 6, V-erbA-related protein 2
Rabbit
IgG
100 ul
GPCR
Primary
2063
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit