Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ECH1, Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit Polyclonal Antibody

Manufacturer:  Abnova Corporation PAB31369

Catalog No. 89-998-358


Add to cart

Description

Description

Sequence: EVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTF
Specifications

Specifications

ECH1
Unconjugated
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Liquid
ECH1
Recombinant protein corresponding to human ECH1.
100 μL
Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Primary
1891
Immunohistochemistry (Paraffin), Western Blot
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
enoyl Coenzyme A hydratase 1, peroxisomal
HPXEL
Rabbit
IgG
RUO
Antibody
Polyclonal
Human, Mouse, Rat
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit