Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ECH1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154738

 View more versions of this product

Catalog No. NBP154738


Add to cart

Description

Description

ECH1 Polyclonal antibody specifically detects ECH1 in Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

ECH1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
ECH1
Synthetic peptides corresponding to ECH1(enoyl Coenzyme A hydratase 1, peroxisomal) The peptide sequence was selected from the N terminal of ECH1. Peptide sequence PDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDA.
36 kDa
100ul
Lipid and Metabolism
Primary
1891
Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat
Western Blot
Western Blot 1:100-1:2000
Q13011
delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial, delta3,5-delta2,4-dienoyl-CoA isomerase, dienoyl-CoA isomerase, EC 5.3.3.-, enoyl CoA hydratase 1, peroxisomal, enoyl Coenzyme A hydratase 1, peroxisomal, HPXEL, peroxisomal enoyl-CoA hydratase 1
Rabbit
IgG
Protein A purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit