Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ECHDC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | ECHDC2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179298
|
Novus Biologicals
NBP179298 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
ECHDC2 Polyclonal specifically detects ECHDC2 in Human samples. It is validated for Western Blot.Specifications
ECHDC2 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
DKFZp686F0985, DKFZp686K13244, enoyl CoA hydratase domain containing 2, enoyl Coenzyme A hydratase domain containing 2, FLJ10948, FLJ45240, FLJ52213, FLJ52450, FLJ78805, FLJ99576, MGC57155, mitochondrial | |
ECHDC2 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
NP_060751 | |
55268 | |
Synthetic peptide directed towards the middle region of human ECHDC2The immunogen for this antibody is ECHDC2. Peptide sequence TQRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQR. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title