Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ECHDC3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179302
Description
ECHDC3 Polyclonal specifically detects ECHDC3 in Human samples. It is validated for Western Blot.Specifications
ECHDC3 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
EAW86340 | |
ECHDC3 | |
Synthetic peptide directed towards the N terminal of human ECHDC3The immunogen for this antibody is ECHDC3. Peptide sequence SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDY. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Chicken: 92%; Xenopus: 85%. | |
Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Yeast, Zebrafish | |
Purified |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
enoyl CoA hydratase domain containing 3, enoyl Coenzyme A hydratase domain containing 3, FLJ20909, mitochondrial | |
Rabbit | |
Protein A purified | |
RUO | |
79746 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title