Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ECHDC3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | ECHDC3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17930220
|
Novus Biologicals
NBP17930220UL |
20 μL |
Each for $152.22
|
|
NBP179302
|
Novus Biologicals
NBP179302 |
100 μL |
Each for $436.00
|
|
Description
ECHDC3 Polyclonal specifically detects ECHDC3 in Human samples. It is validated for Western Blot.Specifications
| ECHDC3 | |
| Polyclonal | |
| Purified | |
| RUO | |
| EAW86340 | |
| 79746 | |
| Synthetic peptide directed towards the N terminal of human ECHDC3The immunogen for this antibody is ECHDC3. Peptide sequence SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDY. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| enoyl CoA hydratase domain containing 3, enoyl Coenzyme A hydratase domain containing 3, FLJ20909, mitochondrial | |
| ECHDC3 | |
| IgG | |
| Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title