Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EDEM1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15996320UL
Description
EDEM1 Polyclonal specifically detects EDEM1 in Human samples. It is validated for Western Blot.Specifications
EDEM1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q92611 | |
EDEM1 | |
Synthetic peptides corresponding to EDEM1(ER degradation enhancer, mannosidase alpha-like 1) The peptide sequence was selected from the N terminal of EDEM1. Peptide sequence MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI. | |
20 μL | |
Lipid and Metabolism | |
9695 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EDEMKIAA0212ER degradation-enhancing alpha-mannosidase-like 1, ER degradation enhancer, mannosidase alpha-like 1, FLJ51559, FLJ51560 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title