Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EEF1B2 Mouse anti-Human, Mouse, Rat, Clone: 2G10, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant EEF1B2.

Manufacturer:  Abnova Corporation H00001933M18

Catalog No. 89-934-066


Add to cart

Description

Description

This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. [provided by RefSeq]

Sequence: MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGADMLEEQITAFEDYVQSMDVAAFNKI
Specifications

Specifications

EEF1B2
Monoclonal
Unconjugated
PBS with no preservative; pH 7.4
BC000211
EEF1B/EEF1B1/EF1B
Mouse
IgG1,kappa
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
1933
Human, Murine, Rat
ELISA, Western Blot
2G10
Mouse monoclonal antibody raised against a full-length recombinant EEF1B2.
EEF1B2
Purified
EEF1B2
EEF1B2 (AAH00211,1 a.a. ∽ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Protein A/G purification
RUO
Antibody
Monoclonal
Antibody Reactive Against Recombinant Protein.
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit