Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EFCAB4B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen EFCAB4B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155340
View Documents
Novus Biologicals
NBP155340
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

EFCAB4B Polyclonal specifically detects EFCAB4B in Human samples. It is validated for Western Blot.
Specifications

Specifications

EFCAB4B
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
Calcium release-activated calcium channel regulator 2A, CRAC channel regulator 2A, CRACR2A, DKFZp686G13246, EF-hand calcium binding domain 4B, EF-hand calcium-binding domain-containing protein 4B, FLJ33046, FLJ33805, MGC4266
Synthetic peptides corresponding to EFCAB4B(EF-hand calcium binding domain 4B) The peptide sequence was selected from the middle region of EFCAB4B. Peptide sequence KNELECALKRKIAAYDEEIQHLYEEMEQQIKSEKEQFLLKDTERFQARSQ.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
Q9BSW2
84766
IgG
Affinity Purified
45 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit