Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EFCAB4B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | EFCAB4B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155340
|
Novus Biologicals
NBP155340 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
EFCAB4B Polyclonal specifically detects EFCAB4B in Human samples. It is validated for Western Blot.Specifications
| EFCAB4B | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Calcium release-activated calcium channel regulator 2A, CRAC channel regulator 2A, CRACR2A, DKFZp686G13246, EF-hand calcium binding domain 4B, EF-hand calcium-binding domain-containing protein 4B, FLJ33046, FLJ33805, MGC4266 | |
| Synthetic peptides corresponding to EFCAB4B(EF-hand calcium binding domain 4B) The peptide sequence was selected from the middle region of EFCAB4B. Peptide sequence KNELECALKRKIAAYDEEIQHLYEEMEQQIKSEKEQFLLKDTERFQARSQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9BSW2 | |
| 84766 | |
| IgG | |
| Affinity Purified | |
| 45 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title