Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EHD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | EHD1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179481
|
Novus Biologicals
NBP179481 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
EHD1 Polyclonal specifically detects EHD1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| EHD1 | |
| Unconjugated | |
| RUO | |
| NP_006786 | |
| 10938 | |
| Synthetic peptide directed towards the middle region of human EHD1The immunogen for this antibody is EHD1. Peptide sequence AKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EH-domain containing 1 | |
| EHD1 | |
| IgG | |
| Affinity Purified | |
| 60 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title