Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EIF3G Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310537100UL
Description
EIF3G Polyclonal specifically detects EIF3G in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation.Specifications
EIF3G | |
Polyclonal | |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunoprecipitation | |
eIF3 p42, eIF3 p44, eIF-3-delta, eIF3-delta, eIF3g, EIF3-P42, eIF3-p44, EIF3S4eIF-3 RNA-binding subunit, Eukaryotic translation initiation factor 3 RNA-binding subunit, Eukaryotic translation initiation factor 3 subunit 4, eukaryotic translation initiation factor 3 subunit G, eukaryotic translation initiation factor 3 subunit p42, eukaryotic translation initiation factor 3, subunit 4 (delta, 44kD), eukaryotic translation initiation factor 3, subunit 4 delta, 44kDa, eukaryotic translation initiation factor 3, subunit G | |
The immunogen is a synthetic peptide directed towards the middle region of human EIF3G (NP_003746). Peptide sequence LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR | |
100 μg | |
Primary | |
Human, Mouse | |
Purified |
Western Blot, Immunohistochemistry, Immunoprecipitation | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
8666 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction