Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EIF3G Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP310537100UL

 View more versions of this product

Catalog No. NB125975

Add to cart



EIF3G Polyclonal antibody specifically detects EIF3G in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation


PBS buffer, 2% sucrose
eIF3 p42, eIF3 p44, eIF-3-delta, eIF3-delta, eIF3g, EIF3-P42, eIF3-p44, EIF3S4eIF-3 RNA-binding subunit, Eukaryotic translation initiation factor 3 RNA-binding subunit, Eukaryotic translation initiation factor 3 subunit 4, eukaryotic translation initiation factor 3 subunit G, eukaryotic translation initiation factor 3 subunit p42, eukaryotic translation initiation factor 3, subunit 4 (delta, 44kD), eukaryotic translation initiation factor 3, subunit 4 delta, 44kDa, eukaryotic translation initiation factor 3, subunit G
The immunogen is a synthetic peptide directed towards the middle region of human EIF3G (NP_003746). Peptide sequence LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR
100 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Human, Mouse
Western Blot, Immunohistochemistry, Immunoprecipitation
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunoprecipitation
Affinity purified
Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit