Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ELA2A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen ELA2A
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126193
View Documents
Novus Biologicals
NBP310646100UL
100 μg
Each for $352.89
Add to cart
 
NB126194
View Documents
Novus Biologicals
NBP31064625UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

ELA2A Polyclonal antibody specifically detects ELA2A in Human samples. It is validated for Western Blot
Specifications

Specifications

ELA2A
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
63036
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
chymotrypsin-like elastase family member 2A, chymotrypsin-like elastase family, member 2A, EC 3.4.21, EC 3.4.21.71, ELA2Apancreatic elastase 2, elastase 2A, Elastase-2A, pancreatic elastase IIA, PE-1
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CEL2A. Peptide sequence CNGDSGGPLNCQASDGRWQVHGIVSFGSRLGCNYYHKPSVFTRVSNYIDW
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit