Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ELA2A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | ELA2A |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
ELA2A Polyclonal specifically detects ELA2A in Human samples. It is validated for Western Blot.Specifications
| ELA2A | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| chymotrypsin-like elastase family member 2A, chymotrypsin-like elastase family, member 2A, EC 3.4.21, EC 3.4.21.71, ELA2Apancreatic elastase 2, elastase 2A, Elastase-2A, pancreatic elastase IIA, PE-1 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of human ELA2A (NP_254275.1). Peptide sequence TGWGRLQTNGAVPDVLQQGRLLVVDYATCSSSAWWGSSVKTSMICAGGDG | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 63036 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title